IL36RN (NM_173170) Human Recombinant Protein
CAT#: TP305747
Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2
View other "IL36RN" proteins (8)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205747 protein sequence
Red=Cloning site Green=Tags(s) MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775262 |
Locus ID | 26525 |
UniProt ID | Q9UBH0, A0A024R518 |
Cytogenetics | 2q14.1 |
Refseq Size | 2689 |
Refseq ORF | 465 |
Synonyms | FIL1; FIL1(DELTA); FIL1D; IL-36Ra; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; PSORP; PSORS14 |
Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402185 | IL36RN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406658 | IL36RN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402185 | Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 |
USD 396.00 |
|
LY406658 | Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2 |
USD 396.00 |
|
PH305747 | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262) |
USD 2,055.00 |
|
PH311691 | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407) |
USD 2,055.00 |
|
TP311691 | Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 |
USD 823.00 |
|
TP720584 | Purified recombinant protein of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review