SNX8 (NM_013321) Human Recombinant Protein

CAT#: TP305847

Recombinant protein of human sorting nexin 8 (SNX8)

Product Images

Coomassie blue staining of purified SNX8 protein (Cat# TP305847). The protein was produced from HEK293T cells transfected with SNX8 cDNA clone (Cat# RC205847) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205847 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQE
  LLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGA
  DREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFL
  PADIQAQFAISRELIRNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSST
  WGSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYS
  LMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN
  SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 52.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037453
• Locus ID: 29886
• UniProt ID: Q9Y5X2
• Cytogenetics: 7p22.3
• Refseq Size: 4756
• Refseq ORF: 1395
• Synonyms: Mvp1
• Summary: May be involved in several stages of intracellular trafficking. May play a role in intracellular protein transport from early endosomes to the trans-Golgi network.[UniProtKB/Swiss-Prot Function]