PIM1 (NM_002648) Human Recombinant Protein

CAT#: TP305853

Recombinant protein of human pim-1 oncogene (PIM1)

Product Images

Coomassie blue staining of purified PIM1 protein (Cat# TP305853). The protein was produced from HEK293T cells transfected with PIM1 cDNA clone (Cat# RC205853) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205853 representing NM_002648
  Red=Cloning site Green=Tags(s)
  
  MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVE
  KDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQ
  EELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPP
  EWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPT
  FEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002639
• Locus ID: 5292
• UniProt ID: P11309, A0A024RD25
• Cytogenetics: 6p21.2
• Refseq Size: 2684
• Refseq ORF: 939
• Synonyms: PIM
• Summary: The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons (PMIDs:16186805, 1825810).[provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
• Protein Pathways: Acute myeloid leukemia, Jak-STAT signaling pathway