STK38L (NM_015000) Human Recombinant Protein

CAT#: TP306074

Recombinant protein of human serine/threonine kinase 38 like (STK38L)

Product Images

Coomassie blue staining of purified STK38L protein (Cat# TP306074). The protein was produced from HEK293T cells transfected with STK38L cDNA clone (Cat# RC206074) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206074 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH
  ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD
  ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI
  HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA
  YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI
  SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL
  QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: In vitro kinase assay substrate (PMID: 28689759)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055815
• Locus ID: 23012
• UniProt ID: Q9Y2H1
• Cytogenetics: 12p11.23
• Refseq Size: 5110
• Refseq ORF: 1392
• Synonyms: NDR2
• Summary: Involved in the regulation of structural processes in differentiating and mature neuronal cells.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protein Kinase