Adenylate kinase 5 (AK5) (NM_012093) Human Recombinant Protein
CAT#: TP306127
Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206127 representing NM_012093
Red=Cloning site Green=Tags(s) MCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPGNSNFPYRRYD RLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGEL LRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICT PDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDE VFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKC KIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKE AMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAK RLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036225 |
Locus ID | 26289 |
UniProt ID | Q9Y6K8 |
Cytogenetics | 1p31.1 |
Refseq Size | 3937 |
Refseq ORF | 1608 |
Synonyms | AK6 |
Summary | This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403569 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC415983 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403569 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 1 |
USD 325.00 |
|
LY415983 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 2 |
USD 325.00 |
|
PH306127 | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_036225) |
USD 2,055.00 |
|
PH322241 | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_777283) |
USD 2,055.00 |
|
TP322241 | Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review