ZCCHC24 (NM_153367) Human Recombinant Protein

CAT#: TP306200

Recombinant protein of human zinc finger, CCHC domain containing 24 (ZCCHC24)

Product Images

Coomassie blue staining of purified ZCCHC24 protein (Cat# TP306200). The protein was produced from HEK293T cells transfected with ZCCHC24 cDNA clone (Cat# RC206200) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206200 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPVPTAGAAPPELAFGKGRPEQLGSPLHSS
  YLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNK
  GHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKP
  DGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_699198
• Locus ID: 219654
• UniProt ID: Q8N2G6, A0A024QZP0
• Cytogenetics: 10q22.3
• Refseq Size: 4933
• Refseq ORF: 723
• Synonyms: C10orf56; Z3CXXC8