ZDHHC2 (NM_016353) Human Recombinant Protein

CAT#: TP306263

Recombinant protein of human zinc finger, DHHC-type containing 2 (ZDHHC2)

Product Images

Coomassie blue staining of purified ZDHHC2 protein (Cat# TP306263). The protein was produced from HEK293T cells transfected with ZDHHC2 cDNA clone (Cat# RC206263) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206263 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYHLLFAMFVWSY
  WKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRC
  HHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFH
  IMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWL
  LPIFSSLGDGCSFPTCLVNQDPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPG
  KCKAGMSNPALTMENET
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057437
• Locus ID: 51201
• UniProt ID: Q9UIJ5, A0A140VKD9
• Cytogenetics: 8p22
• Refseq Size: 4012
• Refseq ORF: 1101
• Synonyms: DHHC2; ZNF372
• Summary: Palmitoyltransferase specific for GAP43 and DLG4/PSD95.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane