SHC4 (NM_203349) Human Recombinant Protein

CAT#: TP306373

Recombinant protein of human SHC (Src homology 2 domain containing) family, member 4 (SHC4)

Product Images

Coomassie blue staining of purified SHC4 protein (Cat# TP306373). The protein was produced from HEK293T cells transfected with SHC4 cDNA clone (Cat# RC206373) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206373 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGDKGSPQPPHPALAPHLPTE
  DATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRS
  GTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCVEVLQSMRSLD
  FGMRTQVTREAISRLCEAVPGANGAIKKRKPPVEFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQ
  IIANHHMQSISFASGGDPDTTDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPS
  LNTSCESEEVHIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC
  SSVYENCLEQSRAIGNVHPRGVQSQRGTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGNQRSAQPLGSP
  WHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVL
  SGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSLPIISSGSEVSLKQPVRKDNNPALLHSNK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 68.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_976224
• Locus ID: 399694
• UniProt ID: Q6S5L8
• Cytogenetics: 15q21.1
• Refseq Size: 4556
• Refseq ORF: 1890
• Synonyms: RaLP; SHCD
• Summary: Activates both Ras-dependent and Ras-independent migratory pathways in melanomas. Contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Focal adhesion, Glioma, Insulin signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway