SERPINI2 (NM_006217) Human Recombinant Protein

CAT#: TP306445

Recombinant protein of human serpin peptidase inhibitor, clade I (pancpin), member 2 (SERPINI2)

Product Images

Coomassie blue staining of purified SERPINI2 protein (Cat# TP306445). The protein was produced from HEK293T cells transfected with SERPINI2 cDNA clone (Cat# RC206445) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206445 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIQNLMREVKMDTIFLWSLLLLFFGSQASRCSAQKNTEFAVDLYQEVSLSHKDNIIFSPLGITLVLEMVQ
  LGAKGKAQQQIRQTLKQQETSAGEEFFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEF
  FQSAIKLVDFQDAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTQL
  INFTKKNGSTVKIPMMKALLRTKYGYFSESSLNYQVLELSYKGDEFSLIIILPAEGMDIEEVEKLITAQQ
  ILKWLSEMQEEEVEISLPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFFEIN
  EDGSEAATSTGIHIPVIMSLAQSQFIANHPFLFIMKHNPTESILFMGRVTNPDTQEIKGRDLDSL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006208
• Locus ID: 5276
• UniProt ID: O75830, A0A0C4DGW9, B4DDY9
• Cytogenetics: 3q26.1
• Refseq Size: 1678
• Refseq ORF: 1248
• Synonyms: MEPI; PANCPIN; PI14; TSA2004
• Summary: The gene encodes a member of a family of proteins that acts as inhibitors of serine proteases. These proteins function in the regulation of a variety of physiological processes, including coagulation, fibrinolysis, development, malignancy, and inflammation. Expression of the encoded protein may be downregulated during pancreatic carcinogenesis. Alternative splicing results in multiple transcript variants for this gene. [provided by RefSeq, Jan 2013]
• Protein Families: Druggable Genome, Secreted Protein