Apolipoprotein CIII (APOC3) (NM_000040) Human Recombinant Protein

CAT#: TP306566

Recombinant protein of human apolipoprotein C-III (APOC3)

Product Images

HDLn inhibits THP-1 cell adhesion, while HDLLI and HDL/apoC-III have impaired inhibitory ability. THP-1 cells adhered to endothelial cells were labeled with a fluorescent dye. HDLn, HDL from the control group; HDLLI, HDL from patients with lacunar infarction; HDL/apoC-III, HDL with an elevated content of apolipoprotein C-III after incubation of HDL with apoC-III (100 ug/ml, OriGene TP306566). Figure cited from Int J Mol Med, PMID: 29115584

• 

  Coomassie blue staining of purified APOC3 protein (Cat# TP306566). The protein was produced from HEK293T cells transfected with APOC3 cDNA clone (Cat# RC206566) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206566 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL
  KDYWSTVKDKFSEFWDLDPEVRPTSAVAA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Cell treatment (PMID: 29115584)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000031
• Locus ID: 345
• UniProt ID: P02656, A3KPE2
• Cytogenetics: 11q23.3
• Refseq Size: 533
• Refseq ORF: 297
• Synonyms: APOCIII
• Summary: This gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. The encoded protein plays a role in role in the metabolism of these TRLs through multiple modes. This protein has been shown to promote the secretion of VLDL1, inhibit lipoprotein lipase enzyme activity, and delay catabolism of TRL remnants. Mutations in this gene are associated with low plasma triglyceride levels and reduced risk of ischemic cardiovascular disease, and hyperalphalipoproteinemia, which is characterized by elevated levels of high density lipoprotein (HDL) and HDL cholesterol in human patients. This gene and other related genes comprise an apolipoprotein gene cluster on chromosome 11. [provided by RefSeq, Sep 2017]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: PPAR signaling pathway