Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein

CAT#: TP306676

Recombinant protein of human zymogen granule protein 16 homolog (rat) (ZG16)

Product Images

Coomassie blue staining of purified ZG16 protein (Cat# TP306676). The protein was produced from HEK293T cells transfected with ZG16 cDNA clone (Cat# RC206676) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206676 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGK
  VWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLR
  FISGRSGSLIDAIGLHWDVYPTSCSRC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689551
• Locus ID: 653808
• UniProt ID: O60844
• Cytogenetics: 16p11.2
• Refseq Size: 1806
• Refseq ORF: 501
• Synonyms: JCLN; JCLN1; ZG16A
• Summary: May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.[UniProtKB/Swiss-Prot Function]