Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein
CAT#: TP306676
Recombinant protein of human zymogen granule protein 16 homolog (rat) (ZG16)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206676 protein sequence
Red=Cloning site Green=Tags(s) MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGK VWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLR FISGRSGSLIDAIGLHWDVYPTSCSRC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689551 |
Locus ID | 653808 |
UniProt ID | O60844 |
Cytogenetics | 16p11.2 |
Refseq Size | 1806 |
Refseq ORF | 501 |
Synonyms | JCLN; JCLN1; ZG16A |
Summary | May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407589 | ZG16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407589 | Transient overexpression lysate of zymogen granule protein 16 homolog (rat) (ZG16) |
USD 396.00 |
|
PH306676 | ZG16 MS Standard C13 and N15-labeled recombinant protein (NP_689551) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review