AMDHD1 (NM_152435) Human Recombinant Protein

CAT#: TP306763

Recombinant protein of human amidohydrolase domain containing 1 (AMDHD1)

Product Images

Coomassie blue staining of purified AMDHD1 protein (Cat# TP306763). The protein was produced from HEK293T cells transfected with AMDHD1 cDNA clone (Cat# RC206763) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206763 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGGHSLLLENAQQVVLVCARGERFLARDALRSLAVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEE
  IIDCSGKCILPGLVDAHTHPVWAGERVHEFAMKLAGATYMEIHQAGGGIHFTVERTRQATEEELFRSLQQ
  RLQCMMRAGTTLVECKSGYGLDLETELKMLRVIERARRELDIGISATYCGAHSVPKGKTATEAADDIINN
  HLPKLKELGRNGEIHVDNIDVFCEKGVFDLDSTRRILQRGKDIGLQINFHGDELHPMKAAELGAELGAQA
  ISHLEEVSDEGIVAMATARCSAILLPTTAYMLRLKQPRARKMLDEGVIVALGSDFNPNAYCFSMPMVMHL
  ACVNMRMSMPEALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWEHLIYQFGGHHELIEYVIAKG
  KLIYKT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689648
• Locus ID: 144193
• UniProt ID: Q96NU7, B3KVC5
• Cytogenetics: 12q23.1
• Refseq Size: 2143
• Refseq ORF: 1278
• Synonyms: HMFT1272
• Protein Pathways: Histidine metabolism, Metabolic pathways