CYTL1 (NM_018659) Human Recombinant Protein

CAT#: TP306778

Recombinant protein of human cytokine-like 1 (CYTL1)

Product Images

Regulatory action of CYTL-1 protein on the gene expression of Sox9, Col2-a1, and Acan in cultured chondrocytes. Cells were grown in DMEM-F12 medium containing serially-diluted CYTL-1 protein (OriGene TP306778) and used in cDNA template synthesis for qRT-PCR analyses. The house-keeping gene GAPDH served as an internal reference. * P < 0.05; ** P < 0.01. Figure cited from J Cell Mol Med, PMID: 28244648

• 

  Coomassie blue staining of purified CYTL1 protein (Cat# TP306778). The protein was produced from HEK293T cells transfected with CYTL1 cDNA clone (Cat# RC206778) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206778 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV
  LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Cell treatment (PMID: 28244648)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061129
• Locus ID: 54360
• UniProt ID: Q9NRR1
• Cytogenetics: 4p16.2
• Refseq Size: 1019
• Refseq ORF: 408
• Synonyms: C4orf4; C17
• Summary: C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Secreted Protein