DYNC1LI2 (NM_006141) Human Recombinant Protein

CAT#: TP306851

Recombinant protein of human dynein, cytoplasmic 1, light intermediate chain 2 (DYNC1LI2)

Product Images

Coomassie blue staining of purified DYNC1LI2 protein (Cat# TP306851). The protein was produced from HEK293T cells transfected with DYNC1LI2 cDNA clone (Cat# RC206851) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206851 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVFGEDGSGKTTL
  MTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLKFAVSAESLPETLVIFVADMS
  RPWTVMESLQKWASVLREHIDKMKIPPEKMRELERKFVKDFQDYMEPEEGCQGSPQRRGPLTSGSDEENV
  ALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSHLRRFCLQYGAALIYTSVKEEKNL
  DLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVH
  DKELAAEDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIK
  NNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKNSGQKTVLSNVQEELDRMTRKPDSMVTNSSTEN
  EA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006132
• Locus ID: 1783
• UniProt ID: O43237, A0A024R6Z0, Q63HJ8
• Cytogenetics: 16q22.1
• Refseq Size: 4352
• Refseq ORF: 1476
• Synonyms: DNCLI2; LIC2
• Summary: Cytoplasmic dynein is a microtubule-associated motor protein (Hughes et al., 1995 [PubMed 7738094]). See DYNC1H1 (MIM 600112) for general information about dyneins.[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome