C7orf16 (PPP1R17) (NM_006658) Human Recombinant Protein
CAT#: TP307007
Recombinant protein of human chromosome 7 open reading frame 16 (C7orf16), transcript variant 1
View other "PPP1R17" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207007 protein sequence
Red=Cloning site Green=Tags(s) MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK AIVEDDEKDGDKIAI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006649 |
Locus ID | 10842 |
UniProt ID | O96001, A0A090N8N7 |
Cytogenetics | 7p14.3 |
Refseq Size | 1966 |
Refseq ORF | 465 |
Synonyms | C7orf16; GSBS |
Summary | The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
Protein Pathways | Long-term depression |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416501 | PPP1R17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416501 | Transient overexpression lysate of chromosome 7 open reading frame 16 (C7orf16), transcript variant 1 |
USD 396.00 |
|
PH307007 | C7orf16 MS Standard C13 and N15-labeled recombinant protein (NP_006649) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review