C7orf16 (PPP1R17) (NM_006658) Human Recombinant Protein

CAT#: TP307007

Recombinant protein of human chromosome 7 open reading frame 16 (C7orf16), transcript variant 1

Product Images

Coomassie blue staining of purified PPP1R17 protein (Cat# TP307007). The protein was produced from HEK293T cells transfected with PPP1R17 cDNA clone (Cat# RC207007) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207007 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA
  LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK
  AIVEDDEKDGDKIAI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006649
• Locus ID: 10842
• UniProt ID: O96001, A0A090N8N7
• Cytogenetics: 7p14.3
• Refseq Size: 1966
• Refseq ORF: 465
• Synonyms: C7orf16; GSBS
• Summary: The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
• Protein Pathways: Long-term depression