Neurogenin 1 (NEUROG1) (NM_006161) Human Recombinant Protein

CAT#: TP307029

Recombinant protein of human neurogenin 1 (NEUROG1)

Product Images

Coomassie blue staining of purified NEUROG1 protein (Cat# TP307029). The protein was produced from HEK293T cells transfected with NEUROG1 cDNA clone (Cat# RC207029) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207029 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQE
  RRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNY
  IWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDAESWGSGAAAASPLSDPSSPAASEDFTY
  RPGDPVFSFPSLPKDLLHTTPCFIPYH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006152
• Locus ID: 4762
• UniProt ID: Q92886, F1T0H3
• Cytogenetics: 5q31.1
• Refseq Size: 1717
• Refseq ORF: 711
• Synonyms: AKA; bHLHa6; Math4C; NEUROD3; ngn1
• Summary: Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcriptional regulators of neurogenesis (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors