NIM1K (NM_153361) Human Recombinant Protein

CAT#: TP307250

Recombinant protein of human serine/threonine-protein kinase NIM1 (MGC42105)

Product Images

Coomassie blue staining of purified NIM1K protein (Cat# TP307250). The protein was produced from HEK293T cells transfected with NIM1K cDNA clone (Cat# RC207250) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207250 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTAVYMNGGGLVNPHYARWDRRDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKR
  IGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIIRLYEVV
  ETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQIIHRDLKAENVFYTSNTCV
  KVGDFGFSTVSKKGEMLNTFCGSPPYAAPELFRDEHYIGIYVDIWALGVLLYFMVTGTMPFRAETVAKLK
  KSILEGTYSVPPHVSEPCHRLIRGVLQQIPTERYGIDCIMNDEWMQGVPYPTPLEPFQLDPKHLSETSTL
  KEEENEVKSTLEHLGITEEHIRNNQGRDARSSITGVYRIILHRVQRKKALESVPVMMLPDPKERDLKKGS
  RVYRGIRHTSKFCSIL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_699192
• Locus ID: 167359
• UniProt ID: Q8IY84
• Cytogenetics: 5p12
• Refseq Size: 2483
• Refseq ORF: 1308
• Synonyms: NIM1
• Protein Families: Druggable Genome, Protein Kinase