UBE2D2 (NM_181838) Human Recombinant Protein
CAT#: TP307283
Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2
View other "UBE2D2" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207283 representing NM_181838
Red=Cloning site Green=Tags(s) MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE WTQKYAM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_862821 |
Locus ID | 7322 |
UniProt ID | P62837 |
Cytogenetics | 5q31.2 |
Refseq Size | 2879 |
Refseq ORF | 441 |
Synonyms | E2(17)KB2; PUBC1; UBC4; UBC4/5; UBCH4; UBCH5B |
Summary | Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405611 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418757 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405611 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2 |
USD 396.00 |
|
LY418757 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1 |
USD 396.00 |
|
PH307283 | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_862821) |
USD 2,055.00 |
|
PH318795 | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_003330) |
USD 2,055.00 |
|
TP318795 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review