Peripherin (PRPH) (NM_006262) Human Recombinant Protein

CAT#: TP307561

Recombinant protein of human peripherin (PRPH), 20 µg

Product Images

Coomassie blue staining of purified PRPH protein (Cat# TP307561). The protein was produced from HEK293T cells transfected with PRPH cDNA clone (Cat# RC207561) using MegaTran 2.0 (Cat# TT210002).

• 

  Recombinant Hu PRPH protein (TP307561) 200ng/mL was coated on plate and incubated at 4°C for overnight. After blocking with 1%BSA, 2x serially diluted primary antibody TA806181 (0.78 to 50ng/mL) and 2000x diluted HRP conjugated goat anti-mouse IgG were used for detection. Signal/Background ratio=51.9, EC50= 6.474ng/ml

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207561 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGAL
  LRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQEPARA
  DQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLFRKDVDDATLS
  RLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNL
  QEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALE
  AGGYQAGAARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK
  TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006253
• Locus ID: 5630
• UniProt ID: P41219
• Cytogenetics: 12q13.12
• Refseq Size: 1833
• Refseq ORF: 1410
• Synonyms: NEF4; PRPH1
• Summary: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis. [provided by RefSeq, Jul 2008]
• Protein Pathways: Amyotrophic lateral sclerosis (ALS)