liver FABP (FABP1) (NM_001443) Human Recombinant Protein

CAT#: TP307592

Recombinant protein of human fatty acid binding protein 1, liver (FABP1)

Product Images

Coomassie blue staining of purified FABP1 protein (Cat# TP307592). The protein was produced from HEK293T cells transfected with FABP1 cDNA clone (Cat# RC207592) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207592 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE
  LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001434
• Locus ID: 2168
• UniProt ID: P07148, Q6FGL7, Q05CP7
• Cytogenetics: 2p11.2
• Refseq Size: 598
• Refseq ORF: 381
• Synonyms: FABPL; L-FABP
• Summary: This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]
• Protein Pathways: PPAR signaling pathway