MD1 (LY86) (NM_004271) Human Recombinant Protein

CAT#: TP307913

Recombinant protein of human lymphocyte antigen 86 (LY86)

Product Images

Coomassie blue staining of purified LY86 protein (Cat# TP307913). The protein was produced from HEK293T cells transfected with LY86 cDNA clone (Cat# RC207913) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207913 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF
  GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV
  LLELYTEKRSTVACANATIMCS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004262
• Locus ID: 9450
• UniProt ID: O95711
• Cytogenetics: 6p25.1
• Refseq Size: 895
• Refseq ORF: 486
• Synonyms: dJ80N2.1; MD-1; MD1; MMD-1
• Summary: May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein