LMBRD1 (NM_018368) Human Recombinant Protein

CAT#: TP307958

Recombinant protein of human LMBR1 domain containing 1 (LMBRD1)

Product Images

Coomassie blue staining of purified LMBRD1 protein (Cat# TP307958). The protein was produced from HEK293T cells transfected with LMBRD1 cDNA clone (Cat# RC207958) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207958 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATSGAASAELVIGWCIFGLLLLAILAFCWIYVRKYQSRRESEVVSTITAIFSLAIALITSALLPVDIFL
  VSYMKNQNGTFKDWANANVSRQIEDTVLYGYYTLYSVILFCVFFWIPFVYFYYEEKDDDDTSKCTQIKTA
  LKYTLGFVVICALLLLVGAFVPLNVPNNKNSTEWEKVKSLFEELGSSHGLAALSFSISSLTLIGMLAAIT
  YTAYGMSALPLNLIKGTRSAAYERLENTEDIEEVEQHIQTIKSKSKDGRPLPARDKRALKQFEERLRTLK
  KRERHLEFIENSWWTKFCGALRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSN
  PLNMLLPLLQTVFPLDYILITIIIMYFIFTSMAGIRNIGIWFFWVRLYKIRRGRTRPQALLFLCMILLLI
  VLHTSYMIYSLAPQYVMYGSQNYLIETNITSDNHKGNSTLSVPKRCDADAPEDQCTVTRTYLFLHKFWFF
  SAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDISDDEPSVYSA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 61.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060838
• Locus ID: 55788
• UniProt ID: Q9NUN5
• Cytogenetics: 6q13
• Refseq Size: 2308
• Refseq ORF: 1620
• Synonyms: C6orf209; LMBD1; MAHCF; NESI
• Summary: This gene encodes a lysosomal membrane protein that may be involved in the transport and metabolism of cobalamin. This protein also interacts with the large form of the hepatitis delta antigen and may be required for the nucleocytoplasmic shuttling of the hepatitis delta virus. Mutations in this gene are associated with the vitamin B12 metabolism disorder termed, homocystinuria-megaloblastic anemia complementation type F.[provided by RefSeq, Oct 2009]
• Protein Families: Transmembrane