LRATD2 (NM_174911) Human Recombinant Protein

CAT#: TP307996

Recombinant protein of human family with sequence similarity 84, member B (FAM84B)

Product Images

Coomassie blue staining of purified LRATD2 protein (Cat# TP307996). The protein was produced from HEK293T cells transfected with LRATD2 cDNA clone (Cat# RC207996) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207996 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQ
  PQPYDPRLHEVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNF
  QVVHLHRLEVINSFLTDASQGRRGRVVNDLYRYKPLSSSAVVRNALAHVGAKERELSWRNSESFAAWCRY
  GKREFKIGGELRIGKQPYRLQIQLSAQRSHTLEFQSLEDLIMEKRRNDQIGRAAVLQELATHLHPAEPEE
  GDSNVARTTPPPGRPPAPSSEEEDGEAVAH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_777571
• Locus ID: 157638
• UniProt ID: Q96KN1
• Cytogenetics: 8q24.21
• Refseq Size: 5503
• Refseq ORF: 930
• Synonyms: BCMP101; FAM84B; NSE2