MRPL43 (NM_176792) Human Recombinant Protein
CAT#: TP308068
Recombinant protein of human mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208068 protein sequence
Red=Cloning site Green=Tags(s) MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPGVVIYVNSRPC CVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTF RGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLPTVDPISSSLTSAPAPMLSAVSCLPIVPALT TVCSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_789762 |
Locus ID | 84545 |
UniProt ID | Q8N983 |
Cytogenetics | 10q24.31 |
Refseq Size | 2151 |
Refseq ORF | 645 |
Synonyms | bMRP36a; L43mt; MRP-L43 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for a semaphorin class 4 protein (SEMA4G) overlap at map location 10q24.31 and are transcribed in opposite directions. Sequence analysis identified multiple transcript variants encoding at least four different protein isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406120 | MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406122 | MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC410343 | MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406120 | Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
LY406122 | Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 325.00 |
|
LY410343 | Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
PH303936 | MRPL43 MS Standard C13 and N15-labeled recombinant protein (NP_115488) |
USD 2,055.00 |
|
PH308068 | MRPL43 MS Standard C13 and N15-labeled recombinant protein (NP_789762) |
USD 2,055.00 |
|
TP303936 | Recombinant protein of human mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review