PCYT1A (NM_005017) Human Recombinant Protein

CAT#: TP308130

Recombinant protein of human phosphate cytidylyltransferase 1, choline, alpha (PCYT1A)

Product Images

Coomassie blue staining of purified PCYT1A protein (Cat# TP308130). The protein was produced from HEK293T cells transfected with PCYT1A cDNA clone (Cat# RC208130) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208130 representing NM_005017
  Red=Cloning site Green=Tags(s)
  
  MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRG
  TPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCR
  YVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIV
  RDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEE
  KSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN
  LSRHKAAAYDISEDEED
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005008
• Locus ID: 5130
• UniProt ID: P49585
• Cytogenetics: 3q29
• Refseq Size: 1677
• Refseq ORF: 1101
• Synonyms: CCTA; CCTalpha; CT; CTA; CTPCT; PCYT1; SMDCRD
• Summary: This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015]
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways