SERPINA12 (NM_173850) Human Recombinant Protein

CAT#: TP308148

Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 (SERPINA12)

Product Images

Coomassie blue staining of purified SERPINA12 protein (Cat# TP308148). The protein was produced from HEK293T cells transfected with SERPINA12 cDNA clone (Cat# RC208148) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208148 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGR
  NIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFI
  DQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFF
  RARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKL
  KHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVG
  EAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_776249
• Locus ID: 145264
• UniProt ID: Q8IW75
• Cytogenetics: 14q32.13
• Refseq Size: 2087
• Refseq ORF: 1242
• Synonyms: OL-64
• Summary: Adipokine that modulates insulin action by specifically inhibiting its target protease KLK7 in white adipose tissues.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein