OLIG2 (NM_005806) Human Recombinant Protein

CAT#: TP308209

Recombinant protein of human oligodendrocyte lineage transcription factor 2 (OLIG2)

Product Images

Coomassie blue staining of purified OLIG2 protein (Cat# TP308209). The protein was produced from HEK293T cells transfected with OLIG2 cDNA clone (Cat# RC208209) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208209 representing NM_005806
  Red=Cloning site Green=Tags(s)
  
  MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL
  GGSGFKXSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG
  PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH
  AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG
  ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005797
• Locus ID: 10215
• UniProt ID: Q13516
• Cytogenetics: 21q22.11
• Refseq Size: 2505
• Refseq ORF: 969
• Synonyms: BHLHB1; bHLHe19; OLIGO2; PRKCBP2; RACK17
• Summary: This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors