S100A9 (NM_002965) Human Recombinant Protein
CAT#: TP308250
Purified recombinant protein of human S100 calcium binding protein A9 (S100A9), with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20ug
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208250 protein sequence
Red=Cloning site Green=Tags(s) MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | Cell treatment (PMID: 26933915) Cell treatment (PMID: 27670158) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002956 |
Locus ID | 6280 |
UniProt ID | P06702 |
Cytogenetics | 1q21.3 |
Refseq Size | 586 |
Refseq ORF | 342 |
Synonyms | 60B8AG; CAGB; CFAG; CGLB; L1AG; LIAG; MAC387; MIF; MRP14; NIF; P14 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401037 | S100A9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401037 | Transient overexpression lysate of S100 calcium binding protein A9 (S100A9) |
USD 325.00 |
|
PH308250 | S100A9 MS Standard C13 and N15-labeled recombinant protein (NP_002956) |
USD 2,055.00 |
|
TP710019 | Recombinant protein of human S100 calcium binding protein A9 (S100A9), full length with N-terminal polyhistidine tag, expressed in sf9 cells. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review