XRCC2 (NM_005431) Human Recombinant Protein
CAT#: TP308330
Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208330 protein sequence
Red=Cloning site Green=Tags(s) MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKS EGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSH PSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPS HASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005422 |
| Locus ID | 7516 |
| UniProt ID | O43543, A0A384MEK2 |
| Cytogenetics | 7q36.1 |
| Refseq Size | 3094 |
| Refseq ORF | 840 |
| Synonyms | FANCU; POF17; SPGF50 |
| Summary | This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Homologous recombination |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417301 | XRCC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY417301 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 2 (XRCC2) |
USD 436.00 |
|
| PH308330 | XRCC2 MS Standard C13 and N15-labeled recombinant protein (NP_005422) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China