CCDC103 (NM_213607) Human Recombinant Protein
CAT#: TP308345
Recombinant protein of human coiled-coil domain containing 103 (CCDC103)
View other "CCDC103" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208345 protein sequence
Red=Cloning site Green=Tags(s) MERNDIINFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLERKDKMGGKRT VPWNCHTIQGRTFQDVATEISPEKAPLQPETSADFYRDWRRHLPSGPERYQALLQLGGPRLGCLFQTDVG FGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKEG LSWEEQGLEEQSGGLQEEERLLQELLELYQVD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_998772 |
Locus ID | 388389 |
UniProt ID | Q8IW40 |
Cytogenetics | 17q21.31 |
Refseq Size | 1766 |
Refseq ORF | 726 |
Synonyms | CILD17; PR46b; SMH |
Summary | This gene encodes a protein that contains a coiled-coil domain. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403885 | CCDC103 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403885 | Transient overexpression lysate of coiled-coil domain containing 103 (CCDC103) |
USD 396.00 |
|
PH308345 | CCDC103 MS Standard C13 and N15-labeled recombinant protein (NP_998772) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review