Staufen (STAU1) (NM_017453) Human Recombinant Protein
CAT#: TP308387
Recombinant protein of human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208387 representing NM_017453
Red=Cloning site Green=Tags(s) MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAES ITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNG KGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGP PHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPE YGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLE ILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPS EQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQS TEMPRTGNGPMSVCGRC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059347 |
Locus ID | 6780 |
UniProt ID | O95793, B3KRE0 |
Cytogenetics | 20q13.13 |
Refseq Size | 3688 |
Refseq ORF | 1731 |
Synonyms | PPP1R150; STAU |
Summary | Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. [provided by RefSeq, Apr 2020] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413756 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC413757 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC413758 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC417883 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421948 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC425616 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429536 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429537 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY413756 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2 |
USD 495.00 |
|
LY413757 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3 |
USD 325.00 |
|
LY413758 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T1 |
USD 495.00 |
|
LY417883 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4 |
USD 325.00 |
|
LY421948 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T5 |
USD 495.00 |
|
LY425616 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T5 |
USD 325.00 |
|
LY429536 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2 |
USD 325.00 |
|
LY429537 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T1 |
USD 325.00 |
|
PH308387 | STAU1 MS Standard C13 and N15-labeled recombinant protein (NP_059347) |
USD 2,055.00 |
|
TP760787 | Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
|
TP761139 | Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review