Munc18c (STXBP3) (NM_007269) Human Recombinant Protein

CAT#: TP308398

Recombinant protein of human syntaxin binding protein 3 (STXBP3)

Product Images

Coomassie blue staining of purified STXBP3 protein (Cat# TP308398). The protein was produced from HEK293T cells transfected with STXBP3 cDNA clone (Cat# RC208398) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208398 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNRE
  PVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISF
  IPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQL
  VEKKLEDYYKIDEKSLIKGKTHSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEA
  ILEEEDDLWVRIRHRHIAVVLEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQITKQVVHLNL
  AEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTE
  ENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRL
  DSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEVSQAHKSCEVI
  IGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 67.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009200
• Locus ID: 6814
• UniProt ID: O00186
• Cytogenetics: 1p13.3
• Refseq Size: 2522
• Refseq ORF: 1776
• Synonyms: MUNC18-3; MUNC18C; PSP; UNC-18C
• Summary: Together with STX4 and VAMP2, may play a role in insulin-dependent movement of GLUT4 and in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes.[UniProtKB/Swiss-Prot Function]
• Protein Families: Stem cell - Pluripotency