ZFP38 (ZSCAN21) (NM_145914) Human Recombinant Protein

CAT#: TP308411

Recombinant protein of human zinc finger and SCAN domain containing 21 (ZSCAN21)

Product Images

Coomassie blue staining of purified ZSCAN21 protein (Cat# TP308411). The protein was produced from HEK293T cells transfected with ZSCAN21 cDNA clone (Cat# RC208411) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208411 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMTKVLGMAPVLGPRPPQEQVGPLMVKVEEKEEKGKYLPSLEMFRQRFRQFGYHDTPGPREALSQLRVLC
  CEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLLEDLERELDEPGHQVSTPPNE
  QKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESAD
  EQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICA
  ECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKH
  QRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKE
  CGKAFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666019
• Locus ID: 7589
• UniProt ID: Q9Y5A6
• Cytogenetics: 7q22.1
• Refseq Size: 2005
• Refseq ORF: 1419
• Synonyms: NY-REN-21; Zipro1; ZNF38
• Summary: Strong transcriptional activator.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors