SRC (NM_005417) Human Recombinant Protein
CAT#: TP308622
Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208622 representing NM_005417
Red=Cloning site Green=Tags(s) MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSS DTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYV APSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKL DSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGC FGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLL DFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC PESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005408 |
Locus ID | 6714 |
UniProt ID | P12931 |
Cytogenetics | 20q11.23 |
Refseq Size | 4145 |
Refseq ORF | 1608 |
Synonyms | ASV; c-SRC; p60-Src; SRC1; THC6 |
Summary | This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Stem cell relevant signaling - JAK/STAT signaling pathway |
Protein Pathways | Adherens junction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Focal adhesion, Gap junction, GnRH signaling pathway, Tight junction, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405010 | SRC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417311 | SRC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405010 | Transient overexpression lysate of v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 2 |
USD 396.00 |
|
LY417311 | Transient overexpression lysate of v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1 |
USD 396.00 |
|
PH308622 | SRC MS Standard C13 and N15-labeled recombinant protein (NP_005408) |
USD 2,055.00 |
|
PH311858 | SRC MS Standard C13 and N15-labeled recombinant protein (NP_938033) |
USD 2,055.00 |
|
TP311858 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 2 |
USD 748.00 |
|
TP710015 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), with N-terminal polyhistidine tag, expressed in sf9 cells. |
USD 425.00 |
|
TP710026 | Recombinant protein of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC),with C-terminal polyhistidine tag, expressed in sf9 cells. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review