VASH2 (NM_024749) Human Recombinant Protein

CAT#: TP308692

Recombinant protein of human vasohibin 2 (VASH2), transcript variant 1

Product Images

Coomassie blue staining of purified VASH2 protein (Cat# TP308692). The protein was produced from HEK293T cells transfected with VASH2 cDNA clone (Cat# RC208692) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208692 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHV
  AKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLHYLTNGQPSIERFPISFKT
  YFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPH
  EPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPR
  RLGRREKSPALPEKKVADLSTLNEVGYQIRI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: ELISA standard (PMID: 27702660)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079025
• Locus ID: 79805
• UniProt ID: Q86V25, A8K4K8
• Cytogenetics: 1q32.3
• Refseq Size: 4362
• Refseq ORF: 933
• Summary: Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed:29146869). Acts as an activator of angiogenesis: expressed in infiltrating mononuclear cells in the sprouting front to promote angiogenesis (PubMed:19204325).[UniProtKB/Swiss-Prot Function]