GSK3 alpha (GSK3A) (NM_019884) Human Recombinant Protein

CAT#: TP308698

Recombinant protein of human glycogen synthase kinase 3 alpha (GSK3A)

Product Images

Tau phosphorylation assay. Tau and pTau were detected in Western blot after a kinase assay reaction in the absence (-) or the presence of Abeta1-40 at 5 (+), 50 (++), or 500 nM (+++), and the absence (-) or the presence (+) of GSK3alpha (OriGene TP308698). Figure cited from ACS Chem Neurosci, PMID: 26618561

• 

  Thermophoresis analysis of the interaction between Abeta42 and GSK3alpha. Thermophoresis time traces at 37 C for the 16 capillaries containing solutions with 60 nM Abeta42 alone and varying concentrations of GSK3alpha (OriGene TP308698) from 0 to 188 nM. The example shown is recorded after 635 min, and the GSK3alpha concentrations are listed as the percentage of the highest (188 nM). Figure cited from ACS Chem Neurosci, PMID: 26618561

• 

  Coomassie blue staining of purified GSK3A protein (Cat# TP308698). The protein was produced from HEK293T cells transfected with GSK3A cDNA clone (Cat# RC208698) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208698 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPG
  GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE
  TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT
  KAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI
  CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN
  YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
  PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: In vitro kinase assay (enzyme) (PMID: 26618561)
  Thermophoresis assay (PMID: 26618561)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_063937
• Locus ID: 2931
• UniProt ID: P49840, A0A024R0L5
• Cytogenetics: 19q13.2
• Refseq Size: 2200
• Refseq ORF: 1449
• Summary: This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Chemokine signaling pathway