Galectin 3 (LGALS3) (NM_002306) Human Recombinant Protein

CAT#: TP308785

Recombinant protein of human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1

Product Images

Coomassie blue staining of purified LGALS3 protein (Cat# TP308785). The protein was produced from HEK293T cells transfected with LGALS3 cDNA clone (Cat# RC208785) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208785 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAY
  PGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP
  NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK
  VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002297
• Locus ID: 3958
• UniProt ID: P17931, A0A024R693
• Cytogenetics: 14q22.3
• Refseq Size: 1017
• Refseq ORF: 750
• Synonyms: CBP35; GAL3; GALBP; GALIG; L31; LGALS2; MAC2
• Summary: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein