IL1RAP (NM_134470) Human Recombinant Protein
CAT#: TP308786
Recombinant protein of human interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208786 protein sequence
Red=Cloning site Green=Tags(s) MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY TCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK GNRCGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_608273 |
Locus ID | 3556 |
UniProt ID | Q9NPH3 |
Cytogenetics | 3q28 |
Refseq Size | 2114 |
Refseq ORF | 1068 |
Synonyms | C3orf13; IL-1RAcP; IL1R3 |
Summary | This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differing in their C-terminus. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. [provided by RefSeq, Jul 2018] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Apoptosis, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400791 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC408731 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC433294 | IL1RAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400791 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 1 |
USD 495.00 |
|
LY408731 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2 |
USD 325.00 |
|
LY433294 | Transient overexpression lysate of interleukin 1 receptor accessory protein (IL1RAP), transcript variant 3 |
USD 325.00 |
|
PH308786 | IL1RAP MS Standard C13 and N15-labeled recombinant protein (NP_608273) |
USD 2,055.00 |
|
TP720670 | Purified recombinant protein of Human interleukin 1 receptor accessory protein (IL1RAP), transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review