TRM11 (TRMT11) (NM_001031712) Human Recombinant Protein

CAT#: TP308923

Recombinant protein of human tRNA methyltransferase 11 homolog (S. cerevisiae) (TRMT11)

Product Images

Coomassie blue staining of purified TRMT11 protein (Cat# TP308923). The protein was produced from HEK293T cells transfected with TRMT11 cDNA clone (Cat# RC208923) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208923 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFWILSIPSEDIARNLMKRTVCA
  KSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLTQEEKIKRIDALEFLPFEGKV
  NLKKPQHVFSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANH
  GKVKENDIVFDPFVGTGGLQIACAHFGAYVYGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLE
  KYYLDVLVSDASKPSWRKGTYFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLS
  DMFLDLLNFAAETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQKLSSHTSRRLITMEKVKKFE
  NRDQYSHLLSDHFLPYQGHNSFREKYFSGVTKRIAKEEKSTQE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001026882
• Locus ID: 60487
• UniProt ID: Q7Z4G4
• Cytogenetics: 6q22.32
• Refseq Size: 1967
• Refseq ORF: 1389
• Synonyms: C6orf75; MDS024; TRM11; TRMT11-1
• Summary: Catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism