SOX9 (NM_000346) Human Recombinant Protein

CAT#: TP308944

Recombinant protein of human SRY (sex determining region Y)-box 9 (SOX9)

Product Images

Recombinant human SOX9 protein directly binds to RASSF3 promoter sequence, but not TOP2A promoter sequence. EMSA was performed with biotin-labeled oligonucleotides for TOP2A and RASSF3 with or without recombinant SOX9 (OriGene TP308944). Excess unlabeled oligonucleotides (cold probe) served as controls. Both sequences contain the SOX9 peak center obtained from ChIP-seq experiments. Western blot was performed on the same membrane used for EMSA to detect recombinant human SOX9 protein. Figure cited from Nucleic Acids Res, PMID: 26040697

• 

  Coomassie blue staining of purified SOX9 protein (Cat# TP308944). The protein was produced from HEK293T cells transfected with SOX9 cDNA clone (Cat# RC208944) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208944 representing NM_000346
  Red=Cloning site Green=Tags(s)
  
  MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFP
  VCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLG
  KLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISPNAIFKALQAD
  SPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSS
  DVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPP
  QAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAY
  SPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIP
  QTHSPQHWEQPVYTQLTRP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 56 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: EMSA assay (PMID: 26040697)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000337
• Locus ID: 6662
• UniProt ID: P48436
• Cytogenetics: 17q24.3
• Refseq Size: 3935
• Refseq ORF: 1527
• Synonyms: CMD1; CMPD1; SRA1; SRXX2; SRXY10
• Summary: The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq, Jul 2008]
• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors