LRRC57 (NM_153260) Human Recombinant Protein

CAT#: TP308959

Recombinant protein of human leucine rich repeat containing 57 (LRRC57)

Product Images

Coomassie blue staining of purified LRRC57 protein (Cat# TP308959). The protein was produced from HEK293T cells transfected with LRRC57 cDNA clone (Cat# RC208959) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208959 representing NM_153260
  Red=Cloning site Green=Tags(s)
  
  MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLN
  NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSK
  NQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEG
  NLFEIKKLRELEGYDKYMERFTATKKKFA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694992
• Locus ID: 255252
• UniProt ID: Q8N9N7, A0A024R9M3
• Cytogenetics: 15q15.2
• Refseq Size: 2647
• Refseq ORF: 717
• Protein Families: Druggable Genome