ORC6L (ORC6) (NM_014321) Human Recombinant Protein

CAT#: TP309054

Recombinant protein of human origin recognition complex, subunit 6 like (yeast) (ORC6L)


  View other "ORC6" proteins (3)

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-ORC6 Antibody
    • 100 ul

USD 375.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "ORC6"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC209054 protein sequence
Red=Cloning site Green=Tags(s)

MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIK
LSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLF
TSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAK
EMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.9 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_055136
Locus ID 23594
UniProt ID Q9Y5N6, A0A024R6R3
Cytogenetics 16q11.2
Refseq Size 1644
Refseq ORF 756
Synonyms ORC6L
Summary The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis. [provided by RefSeq, Oct 2010]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Cell cycle

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.