SUOX (NM_000456) Human Recombinant Protein
CAT#: TP309066
Recombinant protein of human sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209066 protein sequence
Red=Cloning site Green=Tags(s) MLLLHRAVVLRLQQACRLKSIPSRICIQACSTNDSFQPQRPSLTFSGDNSSTQGWRVMGTLLGLGAVLAY QDHRCRAAQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALY AVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPPELLTENYITP NPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKG LEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAY EMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSI QELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRL WQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000447 |
Locus ID | 6821 |
UniProt ID | P51687, A0A024RB79 |
Cytogenetics | 12q13.2 |
Refseq Size | 2564 |
Refseq ORF | 1635 |
Summary | Sulfite oxidase is a homodimeric protein localized to the intermembrane space of mitochondria. Each subunit contains a heme domain and a molybdopterin-binding domain. The enzyme catalyzes the oxidation of sulfite to sulfate, the final reaction in the oxidative degradation of the sulfur amino acids cysteine and methionine. Sulfite oxidase deficiency results in neurological abnormalities which are often fatal at an early age. Alternative splicing results in multiple transcript variants encoding identical proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422321 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC422322 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC424706 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425534 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425535 | SUOX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY422321 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 495.00 |
|
LY422322 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 495.00 |
|
LY424706 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY425534 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
LY425535 | Transient overexpression lysate of sulfite oxidase (SUOX), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 325.00 |
|
PH309066 | SUOX MS Standard C13 and N15-labeled recombinant protein (NP_000447) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review