KIAA1609 (TLDC1) (NM_020947) Human Recombinant Protein

CAT#: TP309287

Recombinant protein of human KIAA1609 (KIAA1609)

Product Images

Coomassie blue staining of purified MEAK7 protein (Cat# TP309287). The protein was produced from HEK293T cells transfected with MEAK7 cDNA clone (Cat# RC209287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPPEMVTRLYDGM
  RRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGPVKAREVQKFTEDLVGSVVHV
  LSHRQELRGWTGKEAPGPNPRVQVLAAQLLSDMKLQDGKRLLGPQWLDYDCDRAVIEDWVFRVPHVAIFL
  SVVICKGFLVLCSSLDLTTLVPERQVDQGRGFESILDVLSVMYINAQLPREQRHRWRLLFSSELHGHSFS
  QLCGHITHRGPCVAVLEDHDKHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNH
  GQQTIPNGLGMGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLA
  KGNKSILDADPEAQALLEISGHSRHSEGLREVPDDE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065998
• Locus ID: 57707
• UniProt ID: Q6P9B6, A8K5C2
• Cytogenetics: 16q24.1
• Refseq Size: 5031
• Refseq ORF: 1368
• Synonyms: KIAA1609; mEAK-7; TLDC1
• Summary: Activates an alternative mTOR signaling through RPS6KB2 activation and EIF4EBP1 repression to regulate cell proliferation and migration (PubMed:29750193). Recruits MTOR at the lysosome, essential for MTOR signaling at the lysosome (PubMed:29750193).[UniProtKB/Swiss-Prot Function]