SSBP3 (NM_145716) Human Recombinant Protein

CAT#: TP309426

Recombinant protein of human single stranded DNA binding protein 3 (SSBP3), transcript variant 1

Product Images

Coomassie blue staining of purified SSBP3 protein (Cat# TP309426). The protein was produced from HEK293T cells transfected with SSBP3 cDNA clone (Cat# RC209426) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209426 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLY
  CAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNP
  SSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMG
  PMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPI
  MPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNN
  ISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663768
• Locus ID: 23648
• UniProt ID: Q9BWW4
• Cytogenetics: 1p32.3
• Refseq Size: 3259
• Refseq ORF: 1164
• Synonyms: CSDP; SSDP; SSDP1
• Summary: May be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors