SSBP3 (NM_145716) Human Recombinant Protein
CAT#: TP309426
Recombinant protein of human single stranded DNA binding protein 3 (SSBP3), transcript variant 1
View other "SSBP3" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209426 protein sequence
Red=Cloning site Green=Tags(s) MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLY CAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNP SSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMG PMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPI MPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNN ISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_663768 |
Locus ID | 23648 |
UniProt ID | Q9BWW4 |
Cytogenetics | 1p32.3 |
Refseq Size | 3259 |
Refseq ORF | 1164 |
Synonyms | CSDP; SSDP; SSDP1 |
Summary | May be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407906 | SSBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC413336 | SSBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407906 | Transient overexpression lysate of single stranded DNA binding protein 3 (SSBP3), transcript variant 1 |
USD 396.00 |
|
LY413336 | Transient overexpression lysate of single stranded DNA binding protein 3 (SSBP3), transcript variant 2 |
USD 396.00 |
|
PH309426 | SSBP3 MS Standard C13 and N15-labeled recombinant protein (NP_663768) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review