TCTN1 (NM_001082537) Human Recombinant Protein
CAT#: TP309467
Recombinant protein of human tectonic family member 1 (TCTN1), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209467 protein sequence
Red=Cloning site Green=Tags(s) MRPRGLPPLLVVLLGCWASVSAQTDATPAVTTEGLNSTEAALATFGTFPSTRPPGTPRAPGPSSGPRPTP VTDVAVLCVCDLSPAQCDINCCCDPDCSSVDFSVFSACSVPVVTGDSQFCSQKAVIYSLNFTANPPQRVF ELVDQINPSIFCIHITNYKPALSFINPEVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYG VPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRK KVPITVQSIVIQSLNKTLTRREDTDVLQPTLVNAGHFSLCVNVVLEVKYSLTYTDAGEVTKADLSFVLGT VSSVVVPLQQKFEIHFLQENTQPVPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQD CLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHF ITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTANLISSSFPEANSGNERTILISTAVTFVDV SAPAEAGFRAPPAINARLPFNFFFPFV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001076006 |
Locus ID | 79600 |
UniProt ID | Q2MV58, B4DIB9 |
Cytogenetics | 12q24.11 |
Refseq Size | 2025 |
Refseq ORF | 1761 |
Synonyms | JBTS13; TECT1 |
Summary | This gene encodes a member of a family of secreted and transmembrane proteins. The orthologous gene in mouse functions downstream of smoothened and rab23 to modulate hedgehog signal transduction. This protein is a component of the tectonic-like complex, which forms a barrier between the ciliary axoneme and the basal body. A mutation in this gene was found in a family with Joubert syndrome-13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411247 | TCTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421188 | TCTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425941 | TCTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411247 | Transient overexpression lysate of tectonic family member 1 (TCTN1), transcript variant 3 |
USD 325.00 |
|
LY421188 | Transient overexpression lysate of tectonic family member 1 (TCTN1), transcript variant 2 |
USD 325.00 |
|
LY425941 | Transient overexpression lysate of tectonic family member 1 (TCTN1), transcript variant 2 |
USD 325.00 |
|
PH309467 | TCTN1 MS Standard C13 and N15-labeled recombinant protein (NP_001076006) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review