p21 ARC (ARPC3) (NM_005719) Human Recombinant Protein

CAT#: TP309711

Recombinant protein of human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3)

Product Images

Coomassie blue staining of purified ARPC3 protein (Cat# TP309711). The protein was produced from HEK293T cells transfected with ARPC3 cDNA clone (Cat# RC209711) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209711 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIY
  ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQET
  GLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005710
• Locus ID: 10094
• UniProt ID: O15145
• Cytogenetics: 12q24.11
• Refseq Size: 962
• Refseq ORF: 534
• Synonyms: ARC21; p21-Arc
• Summary: This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013]
• Protein Pathways: Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton