ATPAF1 (NM_022745) Human Recombinant Protein
CAT#: TP309963
Recombinant protein of human ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), nuclear gene encoding mitochondrial protein, transcript variant 1
View other "ATPAF1" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209963 protein sequence
Red=Cloning site Green=Tags(s) MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAE LQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTK DKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFF VGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFY ATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073582 |
Locus ID | 64756 |
UniProt ID | Q5TC12, I3L448 |
Cytogenetics | 1p33 |
Refseq Size | 1849 |
Refseq ORF | 984 |
Synonyms | ATP11; ATP11p |
Summary | This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411584 | ATPAF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420976 | ATPAF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411584 | Transient overexpression lysate of ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
LY420976 | Transient overexpression lysate of ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 396.00 |
|
PH309963 | ATPAF1 MS Standard C13 and N15-labeled recombinant protein (NP_073582) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review