Proteasome subunit alpha type 6 (PSMA6) (NM_002791) Human Recombinant Protein

CAT#: TP309976

Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6)

Product Images

Coomassie blue staining of purified PSMA6 protein (Cat# TP309976). The protein was produced from HEK293T cells transfected with PSMA6 cDNA clone (Cat# RC209976) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209976 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLF
  KITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIL
  IGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDF
  KPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002782
• Locus ID: 5687
• UniProt ID: P60900, A0A140VK44
• Cytogenetics: 14q13.2
• Refseq Size: 1091
• Refseq ORF: 738
• Synonyms: IOTA; p27K; PROS27
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple transcript variants encoding several different isoforms have been found for this gene. A pseudogene has been identified on the Y chromosome. [provided by RefSeq, Aug 2013]
• Protein Families: Druggable Genome, Protease, Stem cell - Pluripotency
• Protein Pathways: Proteasome