RISC (SCPEP1) (NM_021626) Human Recombinant Protein

CAT#: TP310080

Recombinant protein of human serine carboxypeptidase 1 (SCPEP1)

Product Images

Coomassie blue staining of purified SCPEP1 protein (Cat# TP310080). The protein was produced from HEK293T cells transfected with SCPEP1 cDNA clone (Cat# RC210080) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210080 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAYMFWWLYYATNSCKNFSELPL
  VMWLQGGPGGSSTGFGNFEEIGPLDSDLKPRKTTWLQAASLLFVDNPVGTGFSYVNGSGAYAKDLAMVAS
  DMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKCNFAGVALGDSWISPVDSVL
  SWGPYLYSMSLLEDKGLAEVSKVAEQVLNAVNKGLYREATELWGKAEMIIEQNTDGVNFYNILTKSTPTS
  TMESSLEFTQSHLVCLCQRHVRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVI
  SIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKN
  LAFYWILKAGHMVPSDQGDMALKMMRLVTQQE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067639
• Locus ID: 59342
• UniProt ID: Q9HB40, Q9H2J9
• Cytogenetics: 17q22
• Refseq Size: 1952
• Refseq ORF: 1356
• Synonyms: HSCP1; RISC
• Summary: May be involved in vascular wall and kidney homeostasis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Protease, Secreted Protein